Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF4 Rabbit Polyclonal Antibody (Biotin)

PRPF4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60

UniProt

O43172

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004688

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD276 Rabbit pAb
MBS9148521-01 0.02 mL

CD276 Rabbit pAb

Sign In for Pricing
View Details
CD276 Rabbit pAb
MBS9148521-02 0.1 mL

CD276 Rabbit pAb

Sign In for Pricing
View Details
CD276 Rabbit pAb
MBS9148521-03 5x 0.1 mL

CD276 Rabbit pAb

Sign In for Pricing
View Details
Phospho-PYK2 (Tyr402) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-3400R-BF350-01 20 µL

Phospho-PYK2 (Tyr402) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Phospho-PYK2 (Tyr402) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-3400R-BF350-02 100 µL

Phospho-PYK2 (Tyr402) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
GRIA2 (Glutamate Receptor Ionotropic AMPA 2, Glutamate Receptor AMPA 2, GLUR2, GLURB, GluA2, HBGR2, GluR-K2) (MaxLight 405)
MBS6419241-01 0.1 mL

GRIA2 (Glutamate Receptor Ionotropic AMPA 2, Glutamate Receptor AMPA 2, GLUR2, GLURB, GluA2, HBGR2, GluR-K2) (MaxLight 405)

Sign In for Pricing
View Details