Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFPQ Rabbit Polyclonal Antibody (HRP)

SFPQ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSF, POMP100, PPP1R140

UniProt

P23246

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SFPQ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005057

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)
PKSR030512 20 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)

Sign In for Pricing
View Details
G-protein coupled receptor 30 Rabbit Polyclonal Antibody
ER1803-90 100 µL

G-protein coupled receptor 30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIPPI (IFT57) (NM_018010) Human Over-expression Lysate
LC402637 20 µg

HIPPI (IFT57) (NM_018010) Human Over-expression Lysate

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F10110-01 100 µg

AF/LE Purified Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F10110-02 1 mg

AF/LE Purified Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F10110-03 5 mg

AF/LE Purified Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details