Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFPQ Rabbit Polyclonal Antibody (HRP)

SFPQ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PSF, POMP100, PPP1R140

UniProt

P23246

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SFPQ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005057

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cish activation kit by CRISPRa
GA200734 1 Kit

Mouse Cish activation kit by CRISPRa

Sign In for Pricing
View Details
Gemin 7 (GEMIN7) (NM_001007270) Human Over-expression Lysate
LY423479 100 µg

Gemin 7 (GEMIN7) (NM_001007270) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)
PDMM100157-01 20 µg

Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)
PDMM100157-02 100 µg

Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)
PDMM100157-03 500 µg

Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)
PDMM100157-04 1 mg

Recombinant Mouse IL-7 Rα/CD127 Protein (Fc Tag)

Sign In for Pricing
View Details