Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS1 Rabbit Polyclonal Antibody (HRP)

SFRS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASF, SF2, SFRS1, SF2p33, SRp30a

UniProt

Q07955

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SFRS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_008855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK1 Recombinant Rabbit Monoclonal Antibody [SM01-44]
ET1605-54 100 µL

CDK1 Recombinant Rabbit Monoclonal Antibody [SM01-44]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Morniga M Lectin (black mulberry) -MNA-M-,  15nm
GP-9004-15 1 mL

Colloidal Gold Conjugated Morniga M Lectin (black mulberry) -MNA-M-, 15nm

Sign In for Pricing
View Details
VAX1 Mouse Monoclonal Antibody [Clone ID: OTI1E7]
CF811403 100 µg

VAX1 Mouse Monoclonal Antibody [Clone ID: OTI1E7]

Sign In for Pricing
View Details
Goat IgG (Fcγ Fragment specific), AlpHcAbs® Rabbit antibody (HRP)
HA710020 100 µg

Goat IgG (Fcγ Fragment specific), AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details
CD46 (197-2B1), Biotin conjugate, 0.1mg/mL
BNCB0931-500 1x 500 µL

CD46 (197-2B1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
16S V3-V4 Library Preparation Kit for Illumina (Set D)
70440 96 Preparations

16S V3-V4 Library Preparation Kit for Illumina (Set D)

Sign In for Pricing
View Details