Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NONO Rabbit Polyclonal Antibody (FITC)

NONO Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114

UniProt

Q15233

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NONO

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IF, IHC, WB

NCBI Accession Number

NP_031389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nitrosomonas eutropha Peptide chain release factor 3 (prfC), partial
MBS1483930 Inquire

Recombinant Nitrosomonas eutropha Peptide chain release factor 3 (prfC), partial

Sign In for Pricing
View Details
RAD9A (Cell Cycle Checkpoint Control Protein RAD9A, DNA Repair Exonuclease Rad9 Homolog A, RAD9) (FITC)
MBS6434815-01 0.1 mL

RAD9A (Cell Cycle Checkpoint Control Protein RAD9A, DNA Repair Exonuclease Rad9 Homolog A, RAD9) (FITC)

Sign In for Pricing
View Details
RAD9A (Cell Cycle Checkpoint Control Protein RAD9A, DNA Repair Exonuclease Rad9 Homolog A, RAD9) (FITC)
MBS6434815-02 5x 0.1 mL

RAD9A (Cell Cycle Checkpoint Control Protein RAD9A, DNA Repair Exonuclease Rad9 Homolog A, RAD9) (FITC)

Sign In for Pricing
View Details
IFN-alpha 21/IFNA21, Human
HY-P79070 1 Each

IFN-alpha 21/IFNA21, Human

Sign In for Pricing
View Details
STN 274-297*210-B7541 AC Signs
223782 Card of 1 Pictogram(s)

STN 274-297*210-B7541 AC Signs

Sign In for Pricing
View Details
OR8B6P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV738520 1.0 µg DNA

OR8B6P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details