Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTA-126B4.3 Rabbit Polyclonal Antibody (HRP)

CTA-126B4.3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rrp7, CGI-96, BK126B4.3

UniProt

Q9Y3A4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTA-126B4.3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056518

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Angiopoietin-2/ANG2 (C-Fc)
PKSM041414-01 10 µg

Recombinant Mouse Angiopoietin-2/ANG2 (C-Fc)

Sign In for Pricing
View Details
Recombinant Mouse Angiopoietin-2/ANG2 (C-Fc)
PKSM041414-02 50 µg

Recombinant Mouse Angiopoietin-2/ANG2 (C-Fc)

Sign In for Pricing
View Details
Mouse Glra1 activation kit by CRISPRa
GA201635 1 Kit

Mouse Glra1 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF181 (NM_001029997) Human Recombinant Protein
TP760845 50 µg

ZNF181 (NM_001029997) Human Recombinant Protein

Sign In for Pricing
View Details
CD284 / TLR4 (TLR4/230), 0.2mg/mL
BNUB0230-500 1x 500 µL

CD284 / TLR4 (TLR4/230), 0.2mg/mL

Sign In for Pricing
View Details
Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R01-2G6]
TA421535 100 µL

Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R01-2G6]

Sign In for Pricing
View Details