Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXRED1 Rabbit Polyclonal Antibody (HRP)

FOXRED1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H17, FP634, MC1DN19

UniProt

Q96CU9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FOXRED1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060017

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prkaa1 qPCR Primer Pair
QM07802S 200 Tests

Mouse Prkaa1 qPCR Primer Pair

Sign In for Pricing
View Details
Omphalotin A
orb2564077-01 50 mg

Omphalotin A

Sign In for Pricing
View Details
Omphalotin A
orb2564077-02 10 mg

Omphalotin A

Sign In for Pricing
View Details
NHLH2 Protein Vector (Mouse) (pPB-C-His)
PV205414 500 ng

NHLH2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
KRTAP20 (KRTAP20-2) (NM_181616) Human Tagged Lenti ORF Clone
RC213035L3 10 µg

KRTAP20 (KRTAP20-2) (NM_181616) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRNAM4 CRISPRa sgRNA lentivector (set of three targets)(Human)
48209121 3x 1.0µg DNA

TRNAM4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details