Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM22 Rabbit Polyclonal Antibody (HRP)

RBM22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cwc2, ZC3H16, fSAP47

UniProt

Q9NW64

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBM22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 16 (IL16) ELISA Kit
orb778890-01 48 Tests

Mouse Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 16 (IL16) ELISA Kit
orb778890-02 96 Tests

Mouse Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing
View Details
Olfr872 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
33507154 3x 1.0 µg DNA

Olfr872 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Polyclonal Antibody to VEGFR2 (Ab-1214)
35-1432-50 50 μL

Polyclonal Antibody to VEGFR2 (Ab-1214)

Sign In for Pricing
View Details
P-Hydroxybenzoic acid sodium salt
H09910-01 25 g

P-Hydroxybenzoic acid sodium salt

Sign In for Pricing
View Details
P-Hydroxybenzoic acid sodium salt
H09910-02 100 g

P-Hydroxybenzoic acid sodium salt

Sign In for Pricing
View Details