Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOL6 Rabbit Polyclonal Antibody (FITC)

NOL6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NRAP, UTP22, bA311H10.1

UniProt

Q9H6R4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NOL6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

127kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_075068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit
MBS7222379-01 48 Well

Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit
MBS7222379-02 96 Well

Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit
MBS7222379-03 5x 96 Well

Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit
MBS7222379-04 10x 96 Well

Rabbit Calpain small subunit 2 (CAPNS2) ELISA Kit

Sign In for Pricing
View Details
Mouse Ribonucleotide Reductase M1 (RRM1) ELISA Kit-Sandwich
EK6F441-01 48 Test

Mouse Ribonucleotide Reductase M1 (RRM1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Ribonucleotide Reductase M1 (RRM1) ELISA Kit-Sandwich
EK6F441-02 96 Tests

Mouse Ribonucleotide Reductase M1 (RRM1) ELISA Kit-Sandwich

Sign In for Pricing
View Details