Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM121B Rabbit Polyclonal Antibody (HRP)

FAM121B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIC26, Mic23, My025, FAM121B, MICOS26

UniProt

Q9BUR5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FAM121B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_077027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Proteasome Subunit Alpha Type 2 (PSMA2) ELISA Kit
MBS9939375 Inquire

Fish Proteasome Subunit Alpha Type 2 (PSMA2) ELISA Kit

Sign In for Pricing
View Details
CWC25 Protein Lysate (Human) with C-Ha Tag
17152031 100 µg

CWC25 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PPOX siRNA (Mouse)
MBS8212462-01 15 nmol

PPOX siRNA (Mouse)

Sign In for Pricing
View Details
PPOX siRNA (Mouse)
MBS8212462-02 30 nmol

PPOX siRNA (Mouse)

Sign In for Pricing
View Details
PPOX siRNA (Mouse)
MBS8212462-03 5x 30 nmol

PPOX siRNA (Mouse)

Sign In for Pricing
View Details
STAT6 (AB2086) Rabbit mAb
M3419-01 20 µL

STAT6 (AB2086) Rabbit mAb

Sign In for Pricing
View Details