Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIS3L Rabbit Polyclonal Antibody (FITC)

DIS3L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DIS3L1

UniProt

Q8TF46

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVI

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

NCBI Accession Number

NP_588616

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDK2 Protein Vector (Human) (pPM-C-HA)
PV128412 500 ng

SDK2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human ZNRF3 shRNA (UAS) - Lentiviral human ZNRF3 shRNA (UAS, iRFP) (100)
GTR15140607 1 Vial

Lentiviral human ZNRF3 shRNA (UAS) - Lentiviral human ZNRF3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit
MBS9924466-01 48 Well

Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit
MBS9924466-02 96 Well

Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit
MBS9924466-03 5x 96 Well

Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit
MBS9924466-04 10x 96 Well

Rat Collagen Type XVII Alpha 1 (COL17A1) ELISA Kit

Sign In for Pricing
View Details