Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM11 Rabbit Polyclonal Antibody (HRP)

RBM11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P57052

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBM11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_658983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 3A1 / CYP3A1 (P6), CF568 conjugate, 0.1mg/mL
BNC683058-500 1x 500 µL

Cytochrome P450 3A1 / CYP3A1 (P6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Synaptotagmin V (SYT5) (NM_003180) Human Recombinant Protein
TP308528 20 µg

Synaptotagmin V (SYT5) (NM_003180) Human Recombinant Protein

Sign In for Pricing
View Details
elF2 alpha (EIF2S1) pSer49 Rabbit Polyclonal Antibody
AP08033PU-N 100 µL

elF2 alpha (EIF2S1) pSer49 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plxna1 Mouse Gene Knockout Kit (CRISPR)
KN313500 1 Kit

Plxna1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Multi-Well Plates
DP16VS-9-NS 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details
Dual Apoptosis Assay with NucView® 488 caspase-3 Substrate and Texas Red-Annexin V (50 - 250 assays)
#30030 1 Kit

Dual Apoptosis Assay with NucView® 488 caspase-3 Substrate and Texas Red-Annexin V (50 - 250 assays)

Sign In for Pricing
View Details