Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM11 Rabbit Polyclonal Antibody (HRP)

RBM11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P57052

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBM11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_658983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Golgin 97 Recombinant Rabbit monoclonal Antibody
HA751486 100 µL

Golgin 97 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF405S conjugate, 0.1mg/mL
BNC042624-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adra2b Mouse Gene Knockout Kit (CRISPR)
KN500931 1 Kit

Adra2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPINK6 (NM_205841) Human Over-expression Lysate
LC404267 20 µg

SPINK6 (NM_205841) Human Over-expression Lysate

Sign In for Pricing
View Details
IRE1 (ERN2) (N-term) Rabbit Polyclonal Antibody
AP13752PU-N 400 µL

IRE1 (ERN2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Keto-D-gluconic Acid
TRC-K191315-25MG 25 mg

5-Keto-D-gluconic Acid

Sign In for Pricing
View Details