Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBEAL1 Rabbit Polyclonal Antibody (Biotin)

NBEAL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALS2CR16, ALS2CR17, A530083I02Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NBEAL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_945183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit
MBS9916424-01 48 Well

Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit

Sign In for Pricing
View Details
Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit
MBS9916424-02 96 Well

Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit

Sign In for Pricing
View Details
Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit
MBS9916424-03 5x 96 Well

Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit

Sign In for Pricing
View Details
Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit
MBS9916424-04 10x 96 Well

Mouse Solute Carrier Family 12 Member 5 (SLC12A5) ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor alpha-induced protein 3, TNFAIP3 ELISA Kit
MBS1607185-01 48 Well

Human Tumor necrosis factor alpha-induced protein 3, TNFAIP3 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor alpha-induced protein 3, TNFAIP3 ELISA Kit
MBS1607185-02 96 Well

Human Tumor necrosis factor alpha-induced protein 3, TNFAIP3 ELISA Kit

Sign In for Pricing
View Details