Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX47 Rabbit Polyclonal Antibody (HRP)

DDX47 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RRP3, E4-DBP, HQ0256, MSTP162

UniProt

Q9H0S4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_057439

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF594 conjugate, 0.1mg/mL
BNC941994-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LAMP2 Human Gene Knockout Kit (CRISPR)
KN400456 1 Kit

LAMP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD37 Mouse Monoclonal Antibody [Clone ID: MB-1]
TA386057 200 µg

CD37 Mouse Monoclonal Antibody [Clone ID: MB-1]

Sign In for Pricing
View Details
Amphetaminil (Mixture of Diastereomers)
TRC-A634285-5MG 5 mg

Amphetaminil (Mixture of Diastereomers)

Sign In for Pricing
View Details
NT5C1A (NM_032526) Human Recombinant Protein
TP324617 20 µg

NT5C1A (NM_032526) Human Recombinant Protein

Sign In for Pricing
View Details
CALCOCO1 Polyclonal Antibody
E-AB-52770-01 20 µL

CALCOCO1 Polyclonal Antibody

Sign In for Pricing
View Details