Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT5B Rabbit Polyclonal Antibody (FITC)

WNT5B Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H1J7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human WNT5B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116031

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlor Cyclizine-d4 Dihydrochloride
TRC-C326504-5MG 5 mg

Chlor Cyclizine-d4 Dihydrochloride

Sign In for Pricing
View Details
Human SETD7 activation kit by CRISPRa
GA113003 1 Kit

Human SETD7 activation kit by CRISPRa

Sign In for Pricing
View Details
TMS1 Recombinant Rabbit Monoclonal Antibody [SN07-10]
ET1611-62 100 µL

TMS1 Recombinant Rabbit Monoclonal Antibody [SN07-10]

Sign In for Pricing
View Details
SASH1 (Center) Rabbit Polyclonal Antibody
AP53800PU-N 400 µL

SASH1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Necdin (NDN) ELISA Kit
RD-NDN-Hu-01 96 Tests

Human Necdin (NDN) ELISA Kit

Sign In for Pricing
View Details
Human Necdin (NDN) ELISA Kit
RD-NDN-Hu-02 48 Tests

Human Necdin (NDN) ELISA Kit

Sign In for Pricing
View Details