Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPS2 Rabbit Polyclonal Antibody (HRP)

PRPS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRSII

UniProt

P11908

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRPS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cronobacter sakazakii UPF0259 membrane protein ESA_01554 (ESA_01554)
MBS7037214-01 0.02 mg

Recombinant Cronobacter sakazakii UPF0259 membrane protein ESA_01554 (ESA_01554)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii UPF0259 membrane protein ESA_01554 (ESA_01554)
MBS7037214-02 0.1 mg

Recombinant Cronobacter sakazakii UPF0259 membrane protein ESA_01554 (ESA_01554)

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii UPF0259 membrane protein ESA_01554 (ESA_01554)
MBS7037214-03 5x 0.1 mg

Recombinant Cronobacter sakazakii UPF0259 membrane protein ESA_01554 (ESA_01554)

Sign In for Pricing
View Details
MGST1 Protein Vector (Mouse) (pPM-C-HA)
PV200756 500 ng

MGST1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PCMV-RIPOR1-3xFLAG-Neo Plasmid
PVT71167 2 µg

PCMV-RIPOR1-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
NEUROD6 (Neurogenic Differentiation 6, Atoh2, MATH2, Math-2, NEX1M, bHLHa2) (MaxLight 405) discontinued
249246-ML405 100 µL

NEUROD6 (Neurogenic Differentiation 6, Atoh2, MATH2, Math-2, NEX1M, bHLHa2) (MaxLight 405) discontinued

Sign In for Pricing
View Details