Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHMT Rabbit Polyclonal Antibody (FITC)

BHMT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BHMT1, HEL-S-61p

UniProt

Q93088

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BHMT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001704

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tars2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6354607 1.0 µg DNA

Tars2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PE/Cy5 Anti-mouse/ dog CD80 Antibody *16-10A1*
108001N2-AAT 500 Tests

PE/Cy5 Anti-mouse/ dog CD80 Antibody *16-10A1*

Sign In for Pricing
View Details
Rpp21 Double Nickase Plasmid (h2)
sc-417423-NIC-2 20 µg

Rpp21 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Lentiviral mouse Btg1-ps1 shRNA (UAS) - Lentiviral mouse Btg1-ps1 shRNA (UAS, GFP) plasmid
GTR15215266 1 Vial

Lentiviral mouse Btg1-ps1 shRNA (UAS) - Lentiviral mouse Btg1-ps1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SARS-CoV-2 Nsp14 Gene Tagged ORF Clone (Native Sequence)
VC102581 10 µg

SARS-CoV-2 Nsp14 Gene Tagged ORF Clone (Native Sequence)

Sign In for Pricing
View Details
Trichomonas Vaginalis Antibody
MBS5310998-01 0.5 mg

Trichomonas Vaginalis Antibody

Sign In for Pricing
View Details