Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHK Rabbit Polyclonal Antibody (HRP)

KHK Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P50053

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KHK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_006479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STO-609, CAMKK inhibitor
TBI1036-5MG 5 mg

STO-609, CAMKK inhibitor

Sign In for Pricing
View Details
Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit
MBS734083-01 48 Well

Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit
MBS734083-02 96 Well

Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit
MBS734083-03 5x 96 Well

Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit
MBS734083-04 10x 96 Well

Sheep Stromal Cell Derived Factor 2 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Lenvatinib
C07574-01 5 mg

Lenvatinib

Sign In for Pricing
View Details