Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT8B Rabbit Polyclonal Antibody (HRP)

NAT8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CML2, Hcml2, NAT8BP

UniProt

Q9UHF3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NAT8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_057431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (MaxLight 490)
MBS6389048-01 0.1 mL

PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (MaxLight 490)

Sign In for Pricing
View Details
PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (MaxLight 490)
MBS6389048-02 5x 0.1 mL

PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (MaxLight 490)

Sign In for Pricing
View Details
Mouse B7-1/CD80 protein
orb669312-01 10 µg

Mouse B7-1/CD80 protein

Sign In for Pricing
View Details
Mouse B7-1/CD80 protein
orb669312-02 50 µg

Mouse B7-1/CD80 protein

Sign In for Pricing
View Details
Mouse B7-1/CD80 protein
orb669312-03 500 µg

Mouse B7-1/CD80 protein

Sign In for Pricing
View Details
Colorectal cancer (CRC) with matched cancer adjacent or adjacent normal tissue array
CO1002d each

Colorectal cancer (CRC) with matched cancer adjacent or adjacent normal tissue array

Sign In for Pricing
View Details