Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGTLA4 Rabbit Polyclonal Antibody (HRP)

GGTLA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GGTL6, GGTLA3, GGTLA4, dJ831C21.1, dJ831C21.2

UniProt

Q9BX51

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GGTLA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_563577

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F12 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3735704 1.0 µg DNA

F12 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
C19orf69 (ERICH4) CytoSection
TS425091P5 25 Slides

C19orf69 (ERICH4) CytoSection

Sign In for Pricing
View Details
PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (HRP)
MBS6389046-01 0.1 mL

PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (HRP)

Sign In for Pricing
View Details
PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (HRP)
MBS6389046-02 5x 0.1 mL

PEPD (Xaa-Pro Dipeptidase, X-Pro Dipeptidase, Proline Dipeptidase, Prolidase, Imidodipeptidase, Peptidase D, PRD, MGC10905) (HRP)

Sign In for Pricing
View Details
Klrk1 siRNA Oligos set (Mouse)
25889174 3x 5 nmol

Klrk1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
SLCO2A1 ORF Vector (Human) (pORF)
ORF032553 1.0 µg DNA

SLCO2A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details