Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHAG Rabbit Polyclonal Antibody (HRP)

RHAG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OHS, RH2, OHST, RHNR, Rh50, CD241, RH50A, Rh50GP, SLC42A1

UniProt

Q02094

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RHAG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000315

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A4GALT (N-term) Rabbit Polyclonal Antibody
AP50008PU-N 400 µL

A4GALT (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NCOA4 (NM_001145262) Human Over-expression Lysate
LY428770 100 µg

NCOA4 (NM_001145262) Human Over-expression Lysate

Sign In for Pricing
View Details
DARS Antibody
KC-17097-01 50 μL

DARS Antibody

Sign In for Pricing
View Details
DARS Antibody
KC-17097-02 100 µL

DARS Antibody

Sign In for Pricing
View Details
DARS Antibody
KC-17097-03 1 mL

DARS Antibody

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF568 conjugate, 0.1mg/mL
BNC681692-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (LL025), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details