Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPAIN Rabbit Polyclonal Antibody (HRP)

RPAIN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIP, HRIP

UniProt

Q86UA6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RPAIN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028174

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srfbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7482507 1.0 µg DNA

Srfbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CCDC125 Recombinant Protein (Mouse)
RP121580 100 µg

CCDC125 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Gsdmd 3'UTR Luciferase Stable Cell Line
TU109159 1.0 mL

Gsdmd 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Slc27a3-set siRNA/shRNA/RNAi Lentivector (Mouse)
44077094 4x 500 ng

Slc27a3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Human SYCE3 (NM_001123225) AAV Particle
RC225004A1V 250 µL

Human SYCE3 (NM_001123225) AAV Particle

Sign In for Pricing
View Details
Luteinizing Hormone (LH, CGB4, hLHB, Interstitial Cell Stimulating Hormone, Leutropin, LHB, LSH beta, LSHB, Luteinising Hormone, Luteinizing Hormone beta Polypeptide, Luteinizing Hormone beta Subunit, Lutropin beta Chain, Lutropin Subunit beta) (MaxLight 750) discontinued
L7500-04G-ML750 100 µL

Luteinizing Hormone (LH, CGB4, hLHB, Interstitial Cell Stimulating Hormone, Leutropin, LHB, LSH beta, LSHB, Luteinising Hormone, Luteinizing Hormone beta Polypeptide, Luteinizing Hormone beta Subunit, Lutropin beta Chain, Lutropin Subunit beta) (MaxLight 750) discontinued

Sign In for Pricing
View Details