Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apof Rabbit Polyclonal Antibody (Biotin)

Apof Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Apof

UniProt

Q5M889

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001019522

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M/M033/NT-PP-DIA150/1-B Safety & Regulatory Compliance Signs (No Adhesive)
135379 1 Pack (1 Panel (s) x 1 Pack)

M/M033/NT-PP-DIA150/1-B Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
ADCY2 (Adenylate Cyclase Type 2, Adenylate Cyclase Type II, ATP Pyrophosphate-lyase 2, Adenylyl Cyclase 2, ADCY2, KIAA1060) (MaxLight 490)
122995-ML490 100 µL

ADCY2 (Adenylate Cyclase Type 2, Adenylate Cyclase Type II, ATP Pyrophosphate-lyase 2, Adenylyl Cyclase 2, ADCY2, KIAA1060) (MaxLight 490)

Sign In for Pricing
View Details
Olfr1389 Protein Vector (Mouse) (pPM-C-HA)
PV209204 500 ng

Olfr1389 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TFB2M Antibody - N-terminal region : HRP (ARP34471_T100-HRP)
ARP34471_T100-HRP 100 µL

TFB2M Antibody - N-terminal region : HRP (ARP34471_T100-HRP)

Sign In for Pricing
View Details
CCDC132, CT (CCDC132, KIAA1861, Coiled-coil domain-containing protein 132) (AP) discontinued
033294-AP 200 µL

CCDC132, CT (CCDC132, KIAA1861, Coiled-coil domain-containing protein 132) (AP) discontinued

Sign In for Pricing
View Details
WDR42A (WD Repeat Domain 42A, DKFZp781G1096, FLJ35857, H326, MGC117276, MGC118891, MGC99640) (MaxLight 405) discontinued
253433-ML405 100 µL

WDR42A (WD Repeat Domain 42A, DKFZp781G1096, FLJ35857, H326, MGC117276, MGC118891, MGC99640) (MaxLight 405) discontinued

Sign In for Pricing
View Details