Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGBL1 Rabbit Polyclonal Antibody (HRP)

ITGBL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OSCP, TIED

UniProt

O95965

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ITGBL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat B4galt3 Pre-designed siRNA Set A
SI201267A 1 Each

Rat B4galt3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal ARHGAP4 Antibody [FITC]
NBP2-97914F 0.1 mL

Rabbit Polyclonal ARHGAP4 Antibody [FITC]

Sign In for Pricing
View Details
U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody
abx349818-01 20 µL

U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody

Sign In for Pricing
View Details
U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody
abx349818-02 50 µL

U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody

Sign In for Pricing
View Details
U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody
abx349818-03 100 µL

U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody

Sign In for Pricing
View Details
U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody
abx349818-04 200 µL

U3 small nucleolar RNA-associated protein 18 homolog (UTP18) Antibody

Sign In for Pricing
View Details