Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBEF1 Rabbit Polyclonal Antibody (HRP)

PBEF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VF, PBEF, PBEF1, VISFATIN, 1110035O14Rik

UniProt

P43490

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005737

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETO shRNA Plasmid (h)
sc-35342-SH 20 µg

ETO shRNA Plasmid (h)

Sign In for Pricing
View Details
Lentiviral mouse 1700011L22Rik shRNA (UAS) - Lentiviral mouse 1700011L22Rik shRNA (UAS, iRFP) (25)
GTR15246002 1 Vial

Lentiviral mouse 1700011L22Rik shRNA (UAS) - Lentiviral mouse 1700011L22Rik shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Human IgG F(ab)2 Secondary Antibody [DyLight 405]
NBP2-62594V 0.5 mL

Goat Polyclonal Goat anti-Human IgG F(ab)2 Secondary Antibody [DyLight 405]

Sign In for Pricing
View Details
PRAP1 AAV Vector (Rat) (CMV)
37556106 1 µg

PRAP1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Canine Long-Chain Fatty Acyl CoA ELISA Kit
MBS040787-01 48 Well

Canine Long-Chain Fatty Acyl CoA ELISA Kit

Sign In for Pricing
View Details
Canine Long-Chain Fatty Acyl CoA ELISA Kit
MBS040787-02 96 Well

Canine Long-Chain Fatty Acyl CoA ELISA Kit

Sign In for Pricing
View Details