Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbln1 Rabbit Polyclonal Antibody (Biotin)

Fbln1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D3ZQ25

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Fbln1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FTRPEEIIFLRAVTPLYPANQADIIFDITEGNLRDSFDIIKRYEDGMTVG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001121019

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC 308-NSA-A5-B7527 AC Signs
809873 Card of 1 Pictogram(s)

PIC 308-NSA-A5-B7527 AC Signs

Sign In for Pricing
View Details
INSL5 Double Nickase Plasmid (h)
sc-417448-NIC 20 µg

INSL5 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PPP2R4 (5G3) PE
sc-81607 PE 200 µg/mL

PPP2R4 (5G3) PE

Sign In for Pricing
View Details
ZBTB16 (Zinc Finger and BTB Domain-containing Protein 16, Promyelocytic Leukemia Zinc Finger Protein, PLZF, Zinc Finger Protein 145, ZNF145, Zinc Finger Protein PLZF) (Biotin)
135507-Biotin 100 µL

ZBTB16 (Zinc Finger and BTB Domain-containing Protein 16, Promyelocytic Leukemia Zinc Finger Protein, PLZF, Zinc Finger Protein 145, ZNF145, Zinc Finger Protein PLZF) (Biotin)

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium tpiA Protein (aa 1-261)
VAng-Yyj2816-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Avium tpiA Protein (aa 1-261)

Sign In for Pricing
View Details
Mouse Monoclonal Chromogranin A Antibody (CHGA/777) [Biotin]
NBP2-47848B 0.1 mL

Mouse Monoclonal Chromogranin A Antibody (CHGA/777) [Biotin]

Sign In for Pricing
View Details