Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PXDN Rabbit Polyclonal Antibody (Biotin)

PXDN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PXN, VPO, MG50, PRG2, ASGD7, COPOA, D2S448, D2S448E

UniProt

Q92626

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PXDN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal West Nile Virus Envelope Antibody [Alexa Fluor 532]
NBP2-41057AF532 0.1 mL

Rabbit Polyclonal West Nile Virus Envelope Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
MMP3 Protein Vector (Mouse) (pPB-N-His)
PV201323 500 ng

MMP3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Eef1g (NM_001004223) Rat Tagged ORF Clone Lentiviral Particle
RR205590L4V 200 µL

Eef1g (NM_001004223) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPL13AP25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1908208 1.0 µg DNA

RPL13AP25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
C19orf80/ANGPTL8 Rabbit Polyclonal Antibody (PE)
orb2615417 100 µg

C19orf80/ANGPTL8 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rabbit anti-Citrobacter freundii ECNA Polyclonal Antibody
MBS7160943 Inquire

Rabbit anti-Citrobacter freundii ECNA Polyclonal Antibody

Sign In for Pricing
View Details