Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPPP3 Rabbit Polyclonal Antibody (HRP)

TPPP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P20, CGI-38, TPPP/p20, p25gamma

UniProt

Q9BW30

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TPPP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057224

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human umbilical mesenchimal stem cells derived Extracellular vesicles
JOT-HUMSC-EV-01-01 1E+10Particles

Human umbilical mesenchimal stem cells derived Extracellular vesicles

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) Beta Variant (B.1.351, SA) Spike RBD Recombinant Protein
orb1231030 0.1 mg

SARS-CoV-2 (COVID-19) Beta Variant (B.1.351, SA) Spike RBD Recombinant Protein

Sign In for Pricing
View Details
hsa-miR-1185-1-3p miRNA Inhibitor
MBS8294711-01 10 nmol

hsa-miR-1185-1-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-1185-1-3p miRNA Inhibitor
MBS8294711-02 20 nmol

hsa-miR-1185-1-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-1185-1-3p miRNA Inhibitor
MBS8294711-03 5x 20 nmol

hsa-miR-1185-1-3p miRNA Inhibitor

Sign In for Pricing
View Details
PCMV-STC1 (human) -K106-131-139R-HA
BZ48113 1 Vial

PCMV-STC1 (human) -K106-131-139R-HA

Sign In for Pricing
View Details