Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf127 Rabbit Polyclonal Antibody (HRP)

C9orf127 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NAG5, NGX6, FP588, NAG-5, NGX6a, C9orf127, LINC00950

UniProt

Q5TCW5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C9orf127

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPV

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001036054

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDFIP1, ID (NDFIP1, N4WBP5, NEDD4 family-interacting protein 1, Breast cancer-associated protein SGA-1M, NEDD4 WW domain-binding protein 5, Putative MAPK-activating protein PM13, Putative NF-kappa-B-activating protein 164, Putative NFKB and MAPK-activatin
MBS6324233-01 0.2 mL

NDFIP1, ID (NDFIP1, N4WBP5, NEDD4 family-interacting protein 1, Breast cancer-associated protein SGA-1M, NEDD4 WW domain-binding protein 5, Putative MAPK-activating protein PM13, Putative NF-kappa-B-activating protein 164, Putative NFKB and MAPK-activatin

Sign In for Pricing
View Details
NDFIP1, ID (NDFIP1, N4WBP5, NEDD4 family-interacting protein 1, Breast cancer-associated protein SGA-1M, NEDD4 WW domain-binding protein 5, Putative MAPK-activating protein PM13, Putative NF-kappa-B-activating protein 164, Putative NFKB and MAPK-activatin
MBS6324233-02 5x 0.2 mL

NDFIP1, ID (NDFIP1, N4WBP5, NEDD4 family-interacting protein 1, Breast cancer-associated protein SGA-1M, NEDD4 WW domain-binding protein 5, Putative MAPK-activating protein PM13, Putative NF-kappa-B-activating protein 164, Putative NFKB and MAPK-activatin

Sign In for Pricing
View Details
REA (PHB2) (NM_001144831) Human Tagged ORF Clone Lentiviral Particle
RC226982L1V 200 µL

REA (PHB2) (NM_001144831) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Monoclonal CRY1 Antibody (monoclonal) (M01), Clone: 4H4-1C4
APR11688G 0.1mg

Monoclonal CRY1 Antibody (monoclonal) (M01), Clone: 4H4-1C4

Sign In for Pricing
View Details
Rabbit Polyclonal LOX Antibody
NB100-2527 0.1 mL

Rabbit Polyclonal LOX Antibody

Sign In for Pricing
View Details
EPRS Rabbit Polyclonal Antibody (Biotin)
orb2117224 100 µL

EPRS Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details