Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNASE2B Rabbit Polyclonal Antibody (Biotin)

DNASE2B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DLAD

UniProt

Q5VXD0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DNASE2B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_490649

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASAP1, ID (ASAP1, DDEF1, KIAA1249, Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1, 130kD phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein, ADP-ribosylation factor-directed GTPase-activating protein 1, Development and differentiation-enhancing factor 1, PIP2-dependent ARF1 GAP) (Biotin) discontinued
032117-Biotin 200 µL

ASAP1, ID (ASAP1, DDEF1, KIAA1249, Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1, 130kD phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein, ADP-ribosylation factor-directed GTPase-activating protein 1, Development and differentiation-enhancing factor 1, PIP2-dependent ARF1 GAP) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Bone Morphogenetic Protein 10 (BMP10)
TRV-0015006-01 10 µg

Recombinant Bone Morphogenetic Protein 10 (BMP10)

Sign In for Pricing
View Details
Recombinant Bone Morphogenetic Protein 10 (BMP10)
TRV-0015006-02 50 µg

Recombinant Bone Morphogenetic Protein 10 (BMP10)

Sign In for Pricing
View Details
Recombinant Bone Morphogenetic Protein 10 (BMP10)
TRV-0015006-03 100 µg

Recombinant Bone Morphogenetic Protein 10 (BMP10)

Sign In for Pricing
View Details
Recombinant Bone Morphogenetic Protein 10 (BMP10)
TRV-0015006-04 200 µg

Recombinant Bone Morphogenetic Protein 10 (BMP10)

Sign In for Pricing
View Details
Recombinant Bone Morphogenetic Protein 10 (BMP10)
TRV-0015006-05 500 µg

Recombinant Bone Morphogenetic Protein 10 (BMP10)

Sign In for Pricing
View Details