Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sct Rabbit Polyclonal Antibody (HRP)

Sct Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q08535

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSSSAALPAPPRTPRHSDGMFTSELSRLQDSARLQRLLQGLVGKRSEQDT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARP discontinued
533988-01 30ul

CARP discontinued

Sign In for Pricing
View Details
CARP discontinued
533988-02 100 µL

CARP discontinued

Sign In for Pricing
View Details
Human BHLHE40 Knockout HEK293T cell line
GTR15419633 1 Vial

Human BHLHE40 Knockout HEK293T cell line

Sign In for Pricing
View Details
Lentiviral mouse Map7d2 shRNA (UAS) - Lentiviral mouse Map7d2 shRNA (UAS, GFP) plasmid
GTR15271330 1 Vial

Lentiviral mouse Map7d2 shRNA (UAS) - Lentiviral mouse Map7d2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral human CYFIP2 shRNA (UAS) - Lentiviral human CYFIP2 shRNA (UAS) plasmid
GTR15338278 1 Vial

Lentiviral human CYFIP2 shRNA (UAS) - Lentiviral human CYFIP2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Palladin Rabbit mAb
MBS9469384-01 0.05 mL

Palladin Rabbit mAb

Sign In for Pricing
View Details