Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morc4 Rabbit Polyclonal Antibody (HRP)

Morc4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1559905

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSRNMAKTKNRKQLEELKRTTEKLERVLAERNLFQQKVEELEQEKNHWHS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001053814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1 (Fibroblast Growth Factor Receptor 1, BFGFR, CD331, CEK, FGFBR, FLG, FLJ99988, FLT2, HBGFR, KAL2, N-SAM) (MaxLight 750) discontinued
246098-ML750 100 µL

FGFR1 (Fibroblast Growth Factor Receptor 1, BFGFR, CD331, CEK, FGFBR, FLG, FLJ99988, FLT2, HBGFR, KAL2, N-SAM) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Parecoxib (Sodium) (Standard)
HY-17474AR-01 5 mg

Parecoxib (Sodium) (Standard)

Sign In for Pricing
View Details
Parecoxib (Sodium) (Standard)
HY-17474AR-02 10 mg

Parecoxib (Sodium) (Standard)

Sign In for Pricing
View Details
Parecoxib (Sodium) (Standard)
HY-17474AR-03 25 mg

Parecoxib (Sodium) (Standard)

Sign In for Pricing
View Details
Parecoxib (Sodium) (Standard)
HY-17474AR-04 50 mg

Parecoxib (Sodium) (Standard)

Sign In for Pricing
View Details
Parecoxib (Sodium) (Standard)
HY-17474AR-05 100 mg

Parecoxib (Sodium) (Standard)

Sign In for Pricing
View Details