Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morc4 Rabbit Polyclonal Antibody (HRP)

Morc4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1559905

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSRNMAKTKNRKQLEELKRTTEKLERVLAERNLFQQKVEELEQEKNHWHS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001053814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc (phospho Thr58) Polyclonal Antibody
orb1415440 100 µL

C-Myc (phospho Thr58) Polyclonal Antibody

Sign In for Pricing
View Details
Sox18 3'UTR GFP Stable Cell Line
TU169485 1.0 mL

Sox18 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-PKC delta Rabbit Monoclonal Antibody
MA4629-.1 100 µL

Anti-PKC delta Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Oligodendrocyte Transcription Factor 1 (OLIG1) Mouse ELISA Kit
F5730 96 Tests

Oligodendrocyte Transcription Factor 1 (OLIG1) Mouse ELISA Kit

Sign In for Pricing
View Details
SCNN1B Protein Vector (Mouse) (pPM-C-His)
PV227109 500 ng

SCNN1B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CDKN1C Antibody, FITC conjugated
MBS7103751-01 0.05 mg

CDKN1C Antibody, FITC conjugated

Sign In for Pricing
View Details