Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN2 Rabbit Polyclonal Antibody (Biotin)

CLDN2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OAZON

UniProt

P57739

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLDN2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_065117

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)
TRV-0043919-01 20 µL

Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)
TRV-0043919-02 100 µL

Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)
TRV-0043919-03 200 µL

Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)

Sign In for Pricing
View Details
Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)
TRV-0043919-04 1 mL

Polyclonal Antibody to Glial Fibrillary Acidic Protein (GFAP)

Sign In for Pricing
View Details
Rat Collagen 18 alpha 1 ELISA Kit
CEK1967 96 Tests

Rat Collagen 18 alpha 1 ELISA Kit

Sign In for Pricing
View Details
Dnmt1 Lentiviral Activation Particles (m)
sc-420033-LAC 200 µL

Dnmt1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details