Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parp8 Rabbit Polyclonal Antibody (Biotin)

Parp8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARTD16, D13Ertd275, D13Ertd275e, 2810430O08Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Parp8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LIGILTPSSSSSQPPVRKHFHLAFLHVAKGQEICLHFLIRPGRGKKQDTC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

XP_983188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome p450 2J2 (CYP2J2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A3]
TA503483BM 100 µL

Cytochrome p450 2J2 (CYP2J2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A3]

Sign In for Pricing
View Details
C4orf19 (NM_001104629) Human Over-expression Lysate
LC426210 20 µg

C4orf19 (NM_001104629) Human Over-expression Lysate

Sign In for Pricing
View Details
PERK (EIF2AK3) Human Gene Knockout Kit (CRISPR)
KN214993 1 Kit

PERK (EIF2AK3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), Biotin conjugate, 0.1mg/mL
BNCB3063-500 1x 500 µL

CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apod Mouse Gene Knockout Kit (CRISPR)
KN501420 1 Kit

Apod Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WDR61 (NM_025234) Human Recombinant Protein
TP303963L 1 mg

WDR61 (NM_025234) Human Recombinant Protein

Sign In for Pricing
View Details