Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INADL Rabbit Polyclonal Antibody (FITC)

INADL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cipp, INADL, hINADL, InaD-like

UniProt

Q8NI35

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence DMRNASQETVATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DMRNASQETVATILKCAQGLVQLEIGRLRAGSWTSARTTSQNSQGSQQSA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

196 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

NCBI Accession Number

NP_795352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klk15 3'UTR Lenti-reporter-Luc Vector
25817084 1.0 µg

Klk15 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Endometrial Bleeding Associated Factor (left-right Determination Factor A Transforming Growth Factor Beta Superfamily) (EBAF)
GWB-2A1846 0.05 mg

Endometrial Bleeding Associated Factor (left-right Determination Factor A Transforming Growth Factor Beta Superfamily) (EBAF)

Sign In for Pricing
View Details
SOX18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV624400 1.0 µg DNA

SOX18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
DCAF12 Rabbit Polyclonal Antibody
orb2611-01 50 μL

DCAF12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCAF12 Rabbit Polyclonal Antibody
orb2611-02 100 µL

DCAF12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCAF12 Rabbit Polyclonal Antibody
orb2611-03 200 µL

DCAF12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details