Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2E1 Rabbit Polyclonal Antibody (FITC)

UBE2E1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UBCH6

UniProt

P51965

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBE2E1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003332

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (Cyclopropylsulfinyl) phenylboronic acid
OR361089 1 Each

4- (Cyclopropylsulfinyl) phenylboronic acid

Sign In for Pricing
View Details
Lentiviral mouse Scnn1g shRNA (UAS) - Lentiviral mouse Scnn1g shRNA (UAS, GFP) (100)
GTR15218577 1 Vial

Lentiviral mouse Scnn1g shRNA (UAS) - Lentiviral mouse Scnn1g shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Chromogranin A (CGA, CHG A, Pancreastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, Vasostatin, SPI) (PE)
124982-PE 100 µL

Chromogranin A (CGA, CHG A, Pancreastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, Vasostatin, SPI) (PE)

Sign In for Pricing
View Details
BZRAP1 (Peripheral-Type Benzodiazepine Receptor-Associated Protein 1, PRAX-1, Peripheral Benzodiazepine Receptor-interacting Protein, PBR-IP, RIMS-Binding Protein 1, RIM-BP1, BZRAP1, KIAA0612, RBP1, RIMBP1) (MaxLight 650) discontinued
302297-ML650 100 µL

BZRAP1 (Peripheral-Type Benzodiazepine Receptor-Associated Protein 1, PRAX-1, Peripheral Benzodiazepine Receptor-interacting Protein, PBR-IP, RIMS-Binding Protein 1, RIM-BP1, BZRAP1, KIAA0612, RBP1, RIMBP1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
VCAM1 protein (His tag)
80R-2313 50 ug

VCAM1 protein (His tag)

Sign In for Pricing
View Details
SERPINI1 (PI12, Neuroserpin, Peptidase Inhibitor 12, PI-12, Serpin I1, DKFZp781N13156) (MaxLight 490)
MBS6403913-01 0.1 mL

SERPINI1 (PI12, Neuroserpin, Peptidase Inhibitor 12, PI-12, Serpin I1, DKFZp781N13156) (MaxLight 490)

Sign In for Pricing
View Details