Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2I Rabbit Polyclonal Antibody (Biotin)

UBE2I Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P18, UBC9, C358B7.1

UniProt

P63279

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2I

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003336

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit
MBS7219331-01 48 Well

Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit
MBS7219331-02 96 Well

Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit
MBS7219331-03 5x 96 Well

Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit

Sign In for Pricing
View Details
Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit
MBS7219331-04 10x 96 Well

Rat Ubiquitin-fold modifier 1 (UFM1) ELISA Kit

Sign In for Pricing
View Details
SOST, NT (SOST, Sclerostin) (Biotin) discontinued
042148-Biotin 200 µL

SOST, NT (SOST, Sclerostin) (Biotin) discontinued

Sign In for Pricing
View Details
hsa-miR-589-5p miRNA Inhibitor
MIH03182 2x 5.0 nmol

hsa-miR-589-5p miRNA Inhibitor

Sign In for Pricing
View Details