Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO25 Rabbit Polyclonal Antibody (Biotin)

FBXO25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FBX25

UniProt

Q8TCJ0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO25

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036305

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conical Erlenmeyer 100ml S 2932 Quickfit
QFE10040 5 / PCK

Conical Erlenmeyer 100ml S 2932 Quickfit

Sign In for Pricing
View Details
CD8b (CD8 beta, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2, Ly3, LYT3, MGC119115, T cell Surface Glycoprotein CD8 beta Chain) (HRP)
MBS6250723-01 0.1 mL

CD8b (CD8 beta, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2, Ly3, LYT3, MGC119115, T cell Surface Glycoprotein CD8 beta Chain) (HRP)

Sign In for Pricing
View Details
CD8b (CD8 beta, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2, Ly3, LYT3, MGC119115, T cell Surface Glycoprotein CD8 beta Chain) (HRP)
MBS6250723-02 5x 0.1 mL

CD8b (CD8 beta, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2, Ly3, LYT3, MGC119115, T cell Surface Glycoprotein CD8 beta Chain) (HRP)

Sign In for Pricing
View Details
ALPK2 Protein Vector (Human) (pPB-His-MBP)
PV321418 500 ng

ALPK2 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
4E-BP1 (Phospho-Thr45) Conjugated Antibody
MBS9438561-01 0.1 mL (AF350)

4E-BP1 (Phospho-Thr45) Conjugated Antibody

Sign In for Pricing
View Details
4E-BP1 (Phospho-Thr45) Conjugated Antibody
MBS9438561-02 0.1 mL (AF405)

4E-BP1 (Phospho-Thr45) Conjugated Antibody

Sign In for Pricing
View Details