Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (K128N)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (K128N), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-k128n-tag-free.html

Purity

98.0

Smiles

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) BAG70135.1 (M1-S155, K128N) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTRHD1 (NM_001013663) Human Over-expression Lysate
LY423012 100 µg

PTRHD1 (NM_001013663) Human Over-expression Lysate

Sign In for Pricing
View Details
BORIS Monoclonal Antibody
E53M02196 100 µL

BORIS Monoclonal Antibody

Sign In for Pricing
View Details
HEETWATER450X52CARD-T1-P16 Pipe Markers for Water
N005933 2 Card (2 Marker (s) x 1 Card)

HEETWATER450X52CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Lentiviral human SEC14L5 shRNA (UAS) - Lentiviral human SEC14L5 shRNA (UAS, iRFP) (25)
GTR15339569 1 Vial

Lentiviral human SEC14L5 shRNA (UAS) - Lentiviral human SEC14L5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human SETBP1 (NM_001130110) AAV Particle
RC225305A1V 250 µL

Human SETBP1 (NM_001130110) AAV Particle

Sign In for Pricing
View Details
Dutp (BC019979) Mouse Tagged ORF Clone Lentiviral Particle
MR202022L3V 200 µL

Dutp (BC019979) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details