Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (K128N)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (K128N), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-k128n-tag-free.html

Purity

98.0

Smiles

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) BAG70135.1 (M1-S155, K128N) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABL2B Human Over-expression Lysate
orb1340919 100 µg

RABL2B Human Over-expression Lysate

Sign In for Pricing
View Details
GBD-9 100mg
A24502-100 100 mg

GBD-9 100mg

Sign In for Pricing
View Details
E2F1 (NM_005225) Human Tagged ORF Clone
RG208247 10 µg

E2F1 (NM_005225) Human Tagged ORF Clone

Sign In for Pricing
View Details
STAT5A pTyr694 Rabbit Polyclonal Antibody
AP01696PU-N 100 µg

STAT5A pTyr694 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fam190a ORF Vector (Mouse) (pORF)
19886014 1.0 µg DNA

Fam190a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Danio rerio COP9 signalosome complex subunit 2 (cops2)
orb1647039-01 20 µg

Recombinant Danio rerio COP9 signalosome complex subunit 2 (cops2)

Sign In for Pricing
View Details