Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (K128N)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (K128N), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-k128n-tag-free.html

Purity

98.0

Smiles

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) BAG70135.1 (M1-S155, K128N) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triethyl Citrate
34810-82 25 g

Triethyl Citrate

Sign In for Pricing
View Details
CSH1 Antibody
OASA03222-500UG 0.5 mg

CSH1 Antibody

Sign In for Pricing
View Details
Rabbit Anti-MST3/STK3 antibody
SL7599R-01 50 µL

Rabbit Anti-MST3/STK3 antibody

Sign In for Pricing
View Details
Rabbit Anti-MST3/STK3 antibody
SL7599R-02 100 µL

Rabbit Anti-MST3/STK3 antibody

Sign In for Pricing
View Details
GLEPP1 (PTPRO) (NM_030667) Human Tagged Lenti ORF Clone
RC216766L1 10 µg

GLEPP1 (PTPRO) (NM_030667) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfr135-set siRNA/shRNA/RNAi Lentivector (Mouse)
32800094 4x 500 ng

Olfr135-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details