Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (K128N)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (K128N), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-k128n-tag-free.html

Purity

98.0

Smiles

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) BAG70135.1 (M1-S155, K128N) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MINK1 Double Nickase Plasmid (h)
sc-404966-NIC 20 µg

MINK1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
LINC00328 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV731287 1.0 µg DNA

LINC00328 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
GPX3, Control Peptide (Glutathione Peroxidase 3, GPx-3, GSHPx-3, Extracellular Glutathione Peroxidase, Plasma Glutathione Peroxidase, GPx-P, GSHPx-P, GPXP)
148023 100 µg

GPX3, Control Peptide (Glutathione Peroxidase 3, GPx-3, GSHPx-3, Extracellular Glutathione Peroxidase, Plasma Glutathione Peroxidase, GPx-P, GSHPx-P, GPXP)

Sign In for Pricing
View Details
PEX11G Protein Vector (Rat) (pPM-C-HA)
PV293440 500 ng

PEX11G Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CTNNB1 antibody - N-terminal region (P100600_T100)
P100600_T100 100 µL

CTNNB1 antibody - N-terminal region (P100600_T100)

Sign In for Pricing
View Details
Klri2 (NM_177155) Mouse Tagged Lenti ORF Clone
MR215066L4 10 µg

Klri2 (NM_177155) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details