Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF basic/bFGF, Human (K128N)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].

Product Specifications

Product Name Alternative

FGF basic/bFGF Protein, Human (K128N), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-k128n-tag-free.html

Purity

98.0

Smiles

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Formula

2247 (Gene_ID) BAG70135.1 (M1-S155, K128N) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) RUVA Polyclonal Antibody
MBS7165187 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) RUVA Polyclonal Antibody

Sign In for Pricing
View Details
Rat Phospho Protein Kinase C (PKC) ELISA Kit
abx255950 96 Well

Rat Phospho Protein Kinase C (PKC) ELISA Kit

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse F4/80 Antibody
JOT20139F 25μg

PE/Cyanine5.5 Anti-Mouse F4/80 Antibody

Sign In for Pricing
View Details
(3S,3aR,6aS) -Hexahydrofuro[2,3-b]furan-3-ylcarbonyl Darunavir
428050-01 1 mg

(3S,3aR,6aS) -Hexahydrofuro[2,3-b]furan-3-ylcarbonyl Darunavir

Sign In for Pricing
View Details
(3S,3aR,6aS) -Hexahydrofuro[2,3-b]furan-3-ylcarbonyl Darunavir
428050-02 2.5 mg

(3S,3aR,6aS) -Hexahydrofuro[2,3-b]furan-3-ylcarbonyl Darunavir

Sign In for Pricing
View Details
Human NSUN4 knockdown cell line
ABC-KD10366 1 Vial

Human NSUN4 knockdown cell line

Sign In for Pricing
View Details