Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF186 Rabbit Polyclonal Antibody (FITC)

RNF186 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ20225, RP11-91K11.1

UniProt

Q9NXI6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNF186

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_061935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Castor oil
M19115-01 100 mg

Castor oil

Sign In for Pricing
View Details
Castor oil
M19115-02 200 mg

Castor oil

Sign In for Pricing
View Details
Castor oil
M19115-03 500 mg

Castor oil

Sign In for Pricing
View Details
Castor oil
M19115-04 1 g

Castor oil

Sign In for Pricing
View Details
Amylase, Salivary (alpha-Amylase, AMY1, Amylase alpha 1A Salivary, Amylase Salivary alpha 1A, AMY1A, Amylase alpha 1B Salivary, Amylase Salivary alpha 1B, AMY1B, Amylase alpha 1C Salivary, Amylase Salivary alpha 1C, AMY1C, 1,4-alpha-D-glucan Glucanohydrolase, Glycogenase, Salivary alpha Amylase) discontinued
A2274-06J 100 µg

Amylase, Salivary (alpha-Amylase, AMY1, Amylase alpha 1A Salivary, Amylase Salivary alpha 1A, AMY1A, Amylase alpha 1B Salivary, Amylase Salivary alpha 1B, AMY1B, Amylase alpha 1C Salivary, Amylase Salivary alpha 1C, AMY1C, 1,4-alpha-D-glucan Glucanohydrolase, Glycogenase, Salivary alpha Amylase) discontinued

Sign In for Pricing
View Details
Sumo2+3 Rabbit Polyclonal Antibody (Biotin)
orb456470 100 µL

Sumo2+3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details