Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAM Rabbit Polyclonal Antibody (HRP)

PAM Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAL, PHM

UniProt

P19021

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human PAM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEEYSAPLPALA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000910.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pbx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3784808 1.0 µg DNA

Pbx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit
MBS163680-01 48 Well

Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit

Sign In for Pricing
View Details
Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit
MBS163680-02 96 Well

Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit

Sign In for Pricing
View Details
Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit
MBS163680-03 5x 96 Well

Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit

Sign In for Pricing
View Details
Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit
MBS163680-04 10x 96 Well

Human V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) ELISA Kit

Sign In for Pricing
View Details
IRF-3 (phospho Ser396) Polyclonal Antibody
RA26458-01 50 µL

IRF-3 (phospho Ser396) Polyclonal Antibody

Sign In for Pricing
View Details