Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnmt Rabbit Polyclonal Antibody (Biotin)

Gnmt Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9QXF8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7218892-01 48 Well

Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7218892-02 96 Well

Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7218892-03 5x 96 Well

Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7218892-04 10x 96 Well

Guinea pig Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Blind cave fish CD37 Rabbit Polyclonal Antibody (Fluoro488)
orb3087209 200 µL

Blind cave fish CD37 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
ARHGEF10 (Rho Guanine Nucleotide Exchange Factor 10, KIAA0294, DKFZp686H0726, Gef10, MGC131664)
123503 100 µg

ARHGEF10 (Rho Guanine Nucleotide Exchange Factor 10, KIAA0294, DKFZp686H0726, Gef10, MGC131664)

Sign In for Pricing
View Details