Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG2 Rabbit Polyclonal Antibody (Biotin)

DLG2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PSD93, PSD-93, PPP1R58, chapsyn-110

UniProt

Q15700

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLG2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RAB22A shRNA (UAS) - Lentiviral human RAB22A shRNA (UAS, GFP) (100)
GTR15335316 1 Vial

Lentiviral human RAB22A shRNA (UAS) - Lentiviral human RAB22A shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)
MBS2092909-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)
MBS2092909-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)
MBS2092909-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)
MBS2092909-04 1 mL

Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)
MBS2092909-05 5 mL

Biotin-Linked Polyclonal Antibody to Macrophage Stimulating Protein (MSP)

Sign In for Pricing
View Details