Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC3 Rabbit Polyclonal Antibody (HRP)

ABCC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MLP2, MRP3, ABC31, MOAT-D, cMOAT2, EST90757

UniProt

O15438

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABCC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Smad2 (Ser255) Rabbit pAb
E2382952 100 µL

Phospho-Smad2 (Ser255) Rabbit pAb

Sign In for Pricing
View Details
FAM25B (NM_001137556) Human Tagged ORF Clone
RC226615 10 µg

FAM25B (NM_001137556) Human Tagged ORF Clone

Sign In for Pricing
View Details
USP19 Protein Lysate (Rat) with C-HA Tag
49296036 100 µg

USP19 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Granzyme K (GZMK) Antibody
abx172671-01 200 µg

Granzyme K (GZMK) Antibody

Sign In for Pricing
View Details
Granzyme K (GZMK) Antibody
abx172671-02 1 mg

Granzyme K (GZMK) Antibody

Sign In for Pricing
View Details
Guinea Pig Actin binding LIM protein 2 (ABLIM2) ELISA Kit
GTR10369708 96 Well

Guinea Pig Actin binding LIM protein 2 (ABLIM2) ELISA Kit

Sign In for Pricing
View Details